IGLL1 (NM_020070) Human Tagged ORF Clone

CAT#: RG204494

  • TrueORF®

IGLL1 (tGFP-tagged) - Human immunoglobulin lambda-like polypeptide 1 (IGLL1), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_020070" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 4,000.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


IGLL1 rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms 14.1; AGM2; CD179b; IGL1; IGL5; IGLJ14.1; IGLL; IGO; IGVPB; VPREB2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG204494 representing NM_020070
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCAGGGACAGGCCAGGGGGGCCTTGAGGCCCCTGGTGAGCCAGGCCCCAACCTCAGGCAGCGCT
GGCCCCTGCTGCTGCTGGGTCTGGCCGTGGTAACCCATGGCCTGCTGCGCCCAACAGCTGCATCGCAGAG
CAGGGCCCTGGGCCCTGGAGCCCCTGGAGGAAGCAGCCGGTCCAGCCTGAGGAGCCGGTGGGGCAGGTTC
CTGCTCCAGCGCGGCTCCTGGACTGGCCCCAGGTGCTGGCCCCGGGGGTTTCAATCCAAGCATAACTCAG
TGACGCATGTGTTTGGCAGCGGGACCCAGCTCACCGTTTTAAGTCAGCCCAAGGCCACCCCCTCGGTCAC
TCTGTTCCCGCCGTCCTCTGAGGAGCTCCAAGCCAACAAGGCTACACTGGTGTGTCTCATGAATGACTTT
TATCCGGGAATCTTGACGGTGACCTGGAAGGCAGATGGTACCCCCATCACCCAGGGCGTGGAGATGACCA
CGCCCTCCAAACAGAGCAACAACAAGTACGCGGCCAGCAGCTACCTGAGCCTGACGCCCGAGCAGTGGAG
GTCCCGCAGAAGCTACAGCTGCCAGGTCATGCACGAAGGGAGCACCGTGGAGAAGACGGTGGCCCCTGCA
GAATGTTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG204494 representing NM_020070
Red=Cloning site Green=Tags(s)

MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRF
LLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDF
YPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPA
ECS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020070
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020070.4
RefSeq Size 901 bp
RefSeq ORF 642 bp
Locus ID 3543
UniProt ID P15814
Domains ig, IGc1
Protein Families Secreted Protein
Protein Pathways Primary immunodeficiency
Gene Summary The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. This gene encodes one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. This gene does not undergo rearrangement. Mutations in this gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...