Gpx6 (NM_145451) Mouse Tagged ORF Clone

CAT#: MR202525

  • TrueORF®

Txnrd2 (Myc-DDK-tagged) - Mouse thioredoxin reductase 2 (cDNA clone MGC:5671 IMAGE:3584154), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

ORF Plasmid: DDK tGFP



  "NM_145451" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

CNY 1,416.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Untagged ORF Clone
Synonyms 1700020G18Rik; olfa; olfactory; Ry2d1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202525 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGAAGTTGTGGGGTTCCTGTCTTTTCTCATTGTTTATGGCTGCCTTAGCTCAGGAGACTCTGA
ATCCTCAAAAATCGAAGGTGGATTGCAACAAAGGGGTGACTGGCACCGTCTATGAGTATGGAGCCAACAC
CATAGATGGTGGGGGGTTTGTCAACTTCCAGCAGTATGCAGGAAAGCACATCCTCTTTGTCAACGTGGCA
TCCTTCTGTGGCCTGACAGCTACGTACCCTGAGTTGAACACACTGCAGGAGGAGCTGAAGCCATTCAACG
TCACGGTTTTGGGCTTTCCGTGCAACCAGTTCGGAAAGCAAGAACCTGGAAAGAACTCAGAGATTCTCCT
TGGACTCAAGTATGTGCGTCCAGGCGGTGGCTATGTCCCCAATTTCCAGCTCTTTGAGAAGGGGGATGTG
AACGGAGACAATGAACAAAAGGTTTTTTCTTTCCTAAAGAACTCCTGCCCTCCCACCTCTGAACTTTTTG
GCTCTCCAGAACATCTCTTCTGGGATCCCATGAAGATTCATGATATCCGCTGGAACTTTGAGAAGTTCCT
GGTGGGACCTGATGGAGTCCCTGTCATGCGCTGGTTCCACCATACTCCTGTCAGAATTGTCCAGTCAGAC
ATCATGGAGTACCTAAACCAAACCAGTACCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202525 protein sequence
Red=Cloning site Green=Tags(s)

MAQKLWGSCLFSLFMAALAQETLNPQKSKVDCNKGVTGTVYEYGANTIDGGGFVNFQQYAGKHILFVNVA
SFCGLTATYPELNTLQEELKPFNVTVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGYVPNFQLFEKGDV
NGDNEQKVFSFLKNSCPPTSELFGSPEHLFWDPMKIHDIRWNFEKFLVGPDGVPVMRWFHHTPVRIVQSD
IMEYLNQTSTQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_145451
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_145451.2
RefSeq Size 1262 bp
RefSeq ORF 666 bp
Locus ID 75512
UniProt ID Q91WR8
Gene Summary This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidases catalyze the reduction of a variety of hydroperoxides using glutathione as a specific electron donor substrate, and thereby protect cells against oxidative damage. Expression of this gene is restricted to embryos and adult olfactory epithelium. The mouse and rat orthologs contain a cysteine (Cys) residue at the active site, unlike the human counterpart, which is a selenoprotein, containing selenocysteine (Sec) instead. [provided by RefSeq, Jul 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...