COX7B (NM_001866) Human Tagged ORF Clone
CAT#: RC201999
- TrueORF®
COX7B (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_001866" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | APLCC; LSDMCA2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201999 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTTCCCTTGGTCAAAAGCGCACTAAATCGTCTCCAAGTTCGAAGCATTCAGCAAACAATGGCAAGGC AGAGCCACCAGAAACGTACACCTGATTTTCATGACAAATACGGTAATGCTGTATTAGCTAGTGGAGCCAC TTTCTGTATTGTTACATGGACATATGTAGCAACACAAGTCGGAATAGAATGGAACCTGTCCCCTGTTGGC AGAGTTACCCCAAAGGAATGGAGGAATCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201999 protein sequence
Red=Cloning site Green=Tags(s) MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG RVTPKEWRNQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001866 |
ORF Size | 240 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001866.3 |
RefSeq Size | 456 bp |
RefSeq ORF | 243 bp |
Locus ID | 1349 |
UniProt ID | P24311 |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
MW | 9.2 kDa |
Gene Summary | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22. [provided by RefSeq, Jun 2011] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201999L3 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC201999L4 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein, mGFP tagged |
CNY 5,890.00 |
|
RG201999 | COX7B (tGFP-tagged) - Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein |
CNY 2,800.00 |
|
SC118991 | COX7B (untagged)-Human cytochrome c oxidase subunit VIIb (COX7B), nuclear gene encoding mitochondrial protein |
CNY 1,200.00 |