NCBP2 (NM_001042540) Human Tagged ORF Clone
CAT#: RC221605
- TrueORF®
NCBP2 (Myc-DDK-tagged)-Human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2
ORF Plasmid: tGFP
"NM_001042540" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CBC2; CBP20; NIP1; PIG55 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC221605 representing NM_001042540
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGGTGGCCTCCTGAAGGCGCTGCGCAGCGACTCCTACGTGGAGCTGAGCCAGTACCGGGACCAGC ACTTCCGGGGTGACAATGAAGAACAAGAAAAATTACTGAAGAAAAGCTATGCGGAAAACGCCATGCGGTA CATAAATGGGACGCGTCTGGATGACCGAATCATTCGCACAGACTGGGACGCAGGCTTTAAGGAGGGCAGG CAATACGGCCGTGGGCGATCTGGGGGCCAGGTTCGGGATGAGTATCGGCAGGACTACGATGCTGGGAGAG GAGGCTATGGAAAACTGGCACAGAACCAG AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGATAAGGTTTAA >RC221605 representing NM_001042540
Red=Cloning site Green=Tags(s) MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGR QYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-RsrII Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001042540 |
ORF Size | 309 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001042540.1, NP_001036005.1 |
RefSeq Size | 2016 bp |
RefSeq ORF | 312 bp |
Locus ID | 22916 |
UniProt ID | P52298 |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
MW | 11.8 kDa |
Gene Summary | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC221605L1 | Lenti-ORF clone of NCBP2 (Myc-DDK-tagged)-Human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2 |
CNY 3,600.00 |
|
RC221605L2 | Lenti-ORF clone of NCBP2 (mGFP-tagged)-Human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2 |
CNY 5,890.00 |
|
RC221605L3 | Lenti-ORF clone of NCBP2 (Myc-DDK-tagged)-Human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2 |
CNY 5,890.00 |
|
RC221605L4 | Lenti-ORF clone of NCBP2 (mGFP-tagged)-Human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2 |
CNY 5,890.00 |
|
RG221605 | NCBP2 (tGFP-tagged) - Human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2 |
CNY 4,370.00 |
|
SC311340 | NCBP2 (untagged)-Human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2 |
CNY 3,990.00 |