KCNE4 (NM_080671) Human Tagged ORF Clone

CAT#: RG204246

  • TrueORF®

KCNE4 (tGFP-tagged) - Human potassium voltage-gated channel, Isk-related family, member 4 (KCNE4)

ORF Plasmid: DDK tGFP



  "NM_080671" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 4,000.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms MIRP3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG204246 representing NM_080671
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGAAAATGGAGCCTCTGAACAGCACGCACCCCGGCACCGCCGCCTCCAGCAGCCCCCTGGAGTCCC
GTGCGGCCGGTGGCGGCAGCGGCAATGGCAACGAGTACTTCTACATTCTGGTTGTCATGTCCTTCTACGG
CATTTTCTTGATCGGAATCATGCTGGGCTACATGAAATCCAAGAGGCGGGAGAAGAAGTCCAGCCTCCTG
CTGCTGTACAAAGACGAGGAGCGGCTCTGGGGGGAGGCCATGAAGCCGCTGCCCGTGGTGTCGGGCCTGA
GGTCGGTGCAGGTGCCCCTGATGCTGAACATGCTGCAGGAGAGCGTGGCGCCCGCGCTGTCCTGCACCCT
CTGTTCCATGGAAGGGGACAGCGTGAGCTCCGAGTCCTCCTCCCCGGACGTGCACCTCACCATTCAGGAG
GAGGGGGCAGACGAGGAGCTGGAGGAGACCTCGGAGACGCCCCTCAACGAGAGCAGCGAAGGGTCCTCGG
AGAACATCCATCAGAATTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG204246 representing NM_080671
Red=Cloning site Green=Tags(s)

MLKMEPLNSTHPGTAASSSPLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSLL
LLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQE
EGADEELEETSETPLNESSEGSSENIHQNS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_080671
ORF Size 510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_080671.1, NP_542402.1
RefSeq Size 1204 bp
RefSeq ORF 513 bp
Locus ID 23704
UniProt ID Q8WWG9
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Gene Summary Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the embryo and in adult uterus. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...