OAZ3 (NM_001301371) Human Tagged ORF Clone

CAT#: RG235541

  • TrueORF®

OAZ3 (tGFP-tagged) - Human ornithine decarboxylase antizyme 3 (OAZ3), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001301371" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
2周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-OAZ3 Antibody
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms AZ3; OAZ-t; TISP15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG235541 representing NM_001301371.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAGACCTGAGGGAGGACCCCGGCGTCGGCGGCAGGAAAGGCCCCCGCCAGTGCTGCCTGCGGCGCGC
CGCATCACTTATAAGGAAGAGGAGGACTTGACACTCCAGCCCCGTTCCTGCCTCCAGTGCTCCATGAGA
CCTGAGGGAGGACCCCGGCGTCGGCGGCAGGAAAGGCCCCCGCCAGTGCTGCCTGCGGCGCGCCGCATC
ACTTATAAGGAAGAGGAGGACTTGACACTCCAGCCCCGTTCCTGCCTCCAGTGCTCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG235541
Blue=ORF Red=Cloning site Green=Tag(s)

MRPEGGPRRRRQERPPPVLPAARRITYKEEEDLTLQPRSCLQCSMRPEGGPRRRRQERPPPVLPAARRI
TYKEEEDLTLQPRSCLQCS

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301371
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NM_001301371, NP_001288300
RefSeq Size 753 bp
RefSeq ORF 613 bp
Locus ID 51686
UniProt ID Q9UMX2
MW 10.8 kDa
Gene Summary The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 3, the third member of the antizyme family. Like antizymes 1 and 2, antizyme 3 inhibits ODC activity and polyamine uptake; however, it does not stimulate ODC degradation. Also, while antizymes 1 and 2 have broad tissue distribution, expression of antizyme 3 is restricted to haploid germ cells in testis, suggesting a distinct role for this antizyme in spermiogenesis. Antizyme 3 gene knockout studies showed that homozygous mutant male mice were infertile, and indicated the likely role of this antizyme in the formation of a rigid connection between the sperm head and tail during spermatogenesis. Alternatively spliced transcript variants encoding different isoforms, including one resulting from the use of non-AUG (CUG) translation initiation codon, have been found for this gene. [provided by RefSeq, Dec 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...