OAZ3 (NM_001301371) Human Tagged ORF Clone
CAT#: RC235541
- TrueORF®
OAZ3 (myc-DDK-tagged) - Human ornithine decarboxylase antizyme 3 (OAZ3), transcript variant 3
ORF Plasmid: tGFP
"NM_001301371" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AZ3; OAZ-t; TISP15 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC235541 representing NM_001301371
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGACCTGAGGGAGGACCCCGGCGTCGGCGGCAGGAAAGGCCCCCGCCAGTGCTGCCTGCGGCGCGCC GCATCACTTATAAGGAAGAGGAGGACTTGACACTCCAGCCCCGTTCCTGCCTCCAGTGCTCCATGAGACC TGAGGGAGGACCCCGGCGTCGGCGGCAGGAAAGGCCCCCGCCAGTGCTGCCTGCGGCGCGCCGCATCACT TATAAGGAAGAGGAGGACTTGACACTCCAGCCCCGTTCCTGCCTCCAGTGCTCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC235541 representing NM_001301371
Red=Cloning site Green=Tags(s) MRPEGGPRRRRQERPPPVLPAARRITYKEEEDLTLQPRSCLQCSMRPEGGPRRRRQERPPPVLPAARRIT YKEEEDLTLQPRSCLQCS myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001301371 |
ORF Size | 264 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001301371, NP_001288300 |
RefSeq Size | 753 bp |
RefSeq ORF | 613 bp |
Locus ID | 51686 |
UniProt ID | Q9UMX2 |
MW | 10.8 kDa |
Gene Summary | The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 3, the third member of the antizyme family. Like antizymes 1 and 2, antizyme 3 inhibits ODC activity and polyamine uptake; however, it does not stimulate ODC degradation. Also, while antizymes 1 and 2 have broad tissue distribution, expression of antizyme 3 is restricted to haploid germ cells in testis, suggesting a distinct role for this antizyme in spermiogenesis. Antizyme 3 gene knockout studies showed that homozygous mutant male mice were infertile, and indicated the likely role of this antizyme in the formation of a rigid connection between the sperm head and tail during spermatogenesis. Alternatively spliced transcript variants encoding different isoforms, including one resulting from the use of non-AUG (CUG) translation initiation codon, have been found for this gene. [provided by RefSeq, Dec 2014] |
Documents
Product Manuals |
FAQs |
SDS |