United States
Germany
Japan
United Kingdom
China
ORF36 (NC_009333) Virus Tagged ORF Clone
CAT＃: VC101669
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for ORF36 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129389
View other clones from "Virus" (82)
Need custom modification / cloning service?
Get a free quote
CNY 5,420.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC101669 represents NCBI reference of YP_001129389 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGATGGAAAAGAATGGAGAGGAGGCCCCCTCTGACCCCTCTGCGAAGATCACGGACCCAGTCCTCCG GCGGCGGCCTTACTATATGCCCACGGTGCGCACTGAAGCTGCCAAAGGCAACACGGATCTCAGAGCGGCC ATGGGCATCTACTTGGCAGTTGAACCAGCACATCCAGGTGAGCAAGACAAAAAAGGCTACCGCATACCTG AAAGCTCCCCGAGAATGGGGCCAATGTACTCATCAAGATCCCGATTGGAGTAAGCGGCTCGGGCGGGGGG CCTTCGGTATAATTGTTCCTATATCCGAAGATCTGTGCGTCAAGCAGTTTGACTCACGACGGGAGTTTTT TTACGAAGCCATTGCTAACGACTTGATGCAAGCCACGCGCGAACGCTATCCTATGCATTCCGGAGGAAGT AGATTGCTGGGCTTTGTTCAGCCCTGTATTCCCTGCAGGTCCATTGTCTATCCCAGAATGAAGTGCAATC TCCTGCAACTGGACTGGTCTCAGGTCAACCTGAGCGTCATGGCTGCCGAGTTCACTGGGCTGATGGCGGC AGTCAGCTTCCTGAACCGCTATTGTGGCATGGTGCACTGTGACGTGTCACCCGACAATATCCTGGCAACT GGGGATCTTACTCCAATGAACCCAGGCCGCCTGGTGCTGACTGACTTCGGGAGCGTCGCCCTTCACAGCG GCTCAAAATGGACCAACCTGGTGGTGACTAGCAATCTGGGTTTTAAACAGCATTGTTACGACTTTAGGGT GCCTCCCAAGCTGATTTGCAAGCATCTTTATAAGCCCTCATGCGTGCTGTTCCAGTGCTATCTGAGTAGC CTCGGCAAAATGCATGCTCAGGTTCTGGATCAACCCTACCCCATCAGCCCAAATATGGGGCTGACTATTG ATATGAGCAGCTTGGGCTACACACTTCTCACTTGCTTGGAGTTGTACCTCGACCTGCCCCTGAACAATCC TTTGAAGTTCCTGGGATCCGCGACTCGGGACGGAAGGCCTGAGCCCATGTATTATTTGGGCTTTATGATA CCTCGGGTGGTGATGACACAGATCCTGTCAGCCGTATGGACCATGACGCTGGATCTTGGGTTGGACTGCA CAGGGAAGGCACAGGCTATCCCCATGCGGCAAGAGCATCAGCTGGCCTTTCAGAAGCAGTGCTACCTGTA CAAGGCTAACCAAAAGGCAGAATCTCTCGCCAACTGCTCCGACAAGCTCAATTGTCCTATGCTGAAGTCA CTGGTGCGGAAGCTGCTTGAACGGGATTTCTTCAACCATGGTGGCCACCCCCACACCCGGGGACTGGTCT TT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101669 representing YP_001129389
Red=Cloning sites Green=Tags MRWKRMERRPPLTPLRRSRTQSSGGGLTICPRCALKLPKATRISERPWASTWQLNQHIQVSKTKKATAYL KAPREWGQCTHQDPDWSKRLGRGAFGIIVPISEDLCVKQFDSRREFFYEAIANDLMQATRERYPMHSGGS RLLGFVQPCIPCRSIVYPRMKCNLLQLDWSQVNLSVMAAEFTGLMAAVSFLNRYCGMVHCDVSPDNILAT GDLTPMNPGRLVLTDFGSVALHSGSKWTNLVVTSNLGFKQHCYDFRVPPKLICKHLYKPSCVLFQCYLSS LGKMHAQVLDQPYPISPNMGLTIDMSSLGYTLLTCLELYLDLPLNNPLKFLGSATRDGRPEPMYYLGFMI PRVVMTQILSAVWTMTLDLGLDCTGKAQAIPMRQEHQLAFQKQCYLYKANQKAESLANCSDKLNCPMLKS LVRKLLERDFFNHGGHPHTRGLVF TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_009333 |
| ORF Size | 1332 bp |
| OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Reference Data | |
| RefSeq | NC_009333.1, YP_001129389 |
| RefSeq ORF | 1332 bp |
| Locus ID | 4961434 |
| UniProt ID | Q2HR82 |
| MW | 50.3 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC101630 | Myc-DDK-tagged ORF clone of viral ORF for K1 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129350 |
CNY 3,800.00 |
|
| VC101631 | Myc-DDK-tagged ORF clone of viral ORF for KCP [Human herpesvirus 8], codon optimized for human cell expression, YP_001129351 |
CNY 6,650.00 |
|
| VC101632 | Myc-DDK-tagged ORF clone of viral ORF for ORF6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129352 |
CNY 17,100.00 |
|
| VC101633 | Myc-DDK-tagged ORF clone of viral ORF for ORF7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129353 |
CNY 10,450.00 |
|
| VC101634 | Myc-DDK-tagged ORF clone of viral ORF for ORF8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129354 |
CNY 12,830.00 |
|
| VC101635 | Myc-DDK-tagged ORF clone of viral ORF for ORF9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129355 |
CNY 15,390.00 |
|
| VC101636 | Myc-DDK-tagged ORF clone of viral ORF for ORF10 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129356 |
CNY 5,130.00 |
|
| VC101637 | Myc-DDK-tagged ORF clone of viral ORF for ORF11 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129357 |
CNY 4,940.00 |
|
| VC101638 | Myc-DDK-tagged ORF clone of viral ORF for K2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129358 |
CNY 3,600.00 |
|
| VC101639 | Myc-DDK-tagged ORF clone of viral ORF for ORF2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129359 |
CNY 3,800.00 |
|
| VC101640 | Myc-DDK-tagged ORF clone of viral ORF for K3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129360 |
CNY 3,800.00 |
|
| VC101641 | Myc-DDK-tagged ORF clone of viral ORF for ORF70 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129361 |
CNY 3,990.00 |
|
| VC101642 | Myc-DDK-tagged ORF clone of viral ORF for K4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129362 |
CNY 3,800.00 |
|
| VC101643 | Myc-DDK-tagged ORF clone of viral ORF for K41 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129363 |
CNY 3,800.00 |
|
| VC101644 | Myc-DDK-tagged ORF clone of viral ORF for K42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129364 |
CNY 3,800.00 |
|
| VC101645 | Myc-DDK-tagged ORF clone of viral ORF for K5 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129365 |
CNY 3,800.00 |
|
| VC101646 | Myc-DDK-tagged ORF clone of viral ORF for K6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129366 |
CNY 3,800.00 |
|
| VC101647 | Myc-DDK-tagged ORF clone of viral ORF for K7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129367 |
CNY 3,800.00 |
|
| VC101648 | Myc-DDK-tagged ORF clone of viral ORF for ORF16 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129368 |
CNY 3,800.00 |
|
| VC101649 | Myc-DDK-tagged ORF clone of viral ORF for ORF17 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129369 |
CNY 6,460.00 |
|
| VC101650 | Myc-DDK-tagged ORF clone of viral ORF for ORF175 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129370 |
CNY 3,800.00 |
|
| VC101651 | Myc-DDK-tagged ORF clone of viral ORF for ORF18 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129371 |
CNY 3,800.00 |
|
| VC101652 | Myc-DDK-tagged ORF clone of viral ORF for ORF19 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129372 |
CNY 6,650.00 |
|
| VC101653 | Myc-DDK-tagged ORF clone of viral ORF for ORF20 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129373 |
CNY 3,800.00 |
|
| VC101654 | Myc-DDK-tagged ORF clone of viral ORF for ORF21 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129374 |
CNY 7,030.00 |
|
| VC101655 | Myc-DDK-tagged ORF clone of viral ORF for ORF22 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129375 |
CNY 11,020.00 |
|
| VC101656 | Myc-DDK-tagged ORF clone of viral ORF for ORF23 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129376 |
CNY 4,750.00 |
|
| VC101657 | Myc-DDK-tagged ORF clone of viral ORF for ORF24 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129377 |
CNY 11,310.00 |
|
| VC101658 | Myc-DDK-tagged ORF clone of viral ORF for ORF25 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129378 |
CNY 20,710.00 |
|
| VC101659 | Myc-DDK-tagged ORF clone of viral ORF for ORF26 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129379 |
CNY 3,800.00 |
|
| VC101660 | Myc-DDK-tagged ORF clone of viral ORF for ORF27 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129380 |
CNY 3,800.00 |
|
| VC101661 | Myc-DDK-tagged ORF clone of viral ORF for ORF28 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129381 |
CNY 3,800.00 |
|
| VC101662 | Myc-DDK-tagged ORF clone of viral ORF for ORF29 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129382 |
CNY 10,360.00 |
|
| VC101663 | Myc-DDK-tagged ORF clone of viral ORF for ORF30 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129383 |
CNY 3,800.00 |
|
| VC101664 | Myc-DDK-tagged ORF clone of viral ORF for ORF31 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129384 |
CNY 3,800.00 |
|
| VC101665 | Myc-DDK-tagged ORF clone of viral ORF for ORF32 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129385 |
CNY 5,510.00 |
|
| VC101666 | Myc-DDK-tagged ORF clone of viral ORF for ORF33 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129386 |
CNY 3,990.00 |
|
| VC101667 | Myc-DDK-tagged ORF clone of viral ORF for ORF34 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129387 |
CNY 3,800.00 |
|
| VC101668 | Myc-DDK-tagged ORF clone of viral ORF for ORF35 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129388 |
CNY 3,800.00 |
|
| VC101670 | Myc-DDK-tagged ORF clone of viral ORF for ORF37 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129390 |
CNY 5,890.00 |
|
| VC101671 | Myc-DDK-tagged ORF clone of viral ORF for ORF38 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129391 |
CNY 3,800.00 |
|
| VC101672 | Myc-DDK-tagged ORF clone of viral ORF for ORF39 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129392 |
CNY 4,750.00 |
|
| VC101673 | Myc-DDK-tagged ORF clone of viral ORF for ORF40 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129393 |
CNY 10,070.00 |
|
| VC101674 | Myc-DDK-tagged ORF clone of viral ORF for ORF42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129394 |
CNY 3,800.00 |
|
| VC101675 | Myc-DDK-tagged ORF clone of viral ORF for ORF43 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129395 |
CNY 7,320.00 |
|
| VC101676 | Myc-DDK-tagged ORF clone of viral ORF for ORF44 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129396 |
CNY 11,970.00 |
|
| VC101677 | Myc-DDK-tagged ORF clone of viral ORF for ORF45 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129397 |
CNY 4,940.00 |
|
| VC101678 | Myc-DDK-tagged ORF clone of viral ORF for ORF46 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129398 |
CNY 3,800.00 |
|
| VC101679 | Myc-DDK-tagged ORF clone of viral ORF for ORF47 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129399 |
CNY 3,800.00 |
|
| VC101680 | Myc-DDK-tagged ORF clone of viral ORF for ORF48 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129400 |
CNY 4,750.00 |
|
| VC101681 | Myc-DDK-tagged ORF clone of viral ORF for ORF50 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129401 |
CNY 10,450.00 |
|
| VC101682 | Myc-DDK-tagged ORF clone of viral ORF for ORF49 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129402 |
CNY 3,800.00 |
|
| VC101683 | Myc-DDK-tagged ORF clone of viral ORF for K8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129403 |
CNY 3,800.00 |
|
| VC101684 | Myc-DDK-tagged ORF clone of viral ORF for K81 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129404 |
CNY 3,800.00 |
|
| VC101685 | Myc-DDK-tagged ORF clone of viral ORF for ORF52 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129405 |
CNY 3,800.00 |
|
| VC101686 | Myc-DDK-tagged ORF clone of viral ORF for ORF53 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129406 |
CNY 3,800.00 |
|
| VC101687 | Myc-DDK-tagged ORF clone of viral ORF for ORF54 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129407 |
CNY 3,800.00 |
|
| VC101688 | Myc-DDK-tagged ORF clone of viral ORF for ORF55 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129408 |
CNY 3,800.00 |
|
| VC101689 | Myc-DDK-tagged ORF clone of viral ORF for ORF56 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129409 |
CNY 12,730.00 |
|
| VC101690 | Myc-DDK-tagged ORF clone of viral ORF for ORF57 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129410 |
CNY 5,610.00 |
|
| VC101691 | Myc-DDK-tagged ORF clone of viral ORF for K9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129411 |
CNY 3,656.00 |
|
| VC101692 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129412 |
CNY 13,780.00 |
|
| VC101693 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129413 |
CNY 6,840.00 |
|
| VC101695 | Myc-DDK-tagged ORF clone of viral ORF for ORF58 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129415 |
CNY 4,280.00 |
|
| VC101696 | Myc-DDK-tagged ORF clone of viral ORF for ORF59 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129416 |
CNY 4,750.00 |
|
| VC101697 | Myc-DDK-tagged ORF clone of viral ORF for ORF60 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129417 |
CNY 3,800.00 |
|
| VC101698 | Myc-DDK-tagged ORF clone of viral ORF for ORF61 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129418 |
CNY 12,070.00 |
|
| VC101699 | Myc-DDK-tagged ORF clone of viral ORF for ORF62 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129419 |
CNY 3,800.00 |
|
| VC101700 | Myc-DDK-tagged ORF clone of viral ORF for ORF63 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129420 |
CNY 13,970.00 |
|
| VC101702 | Myc-DDK-tagged ORF clone of viral ORF for ORF65 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129422 |
CNY 3,800.00 |
|
| VC101703 | Myc-DDK-tagged ORF clone of viral ORF for ORF66 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129423 |
CNY 5,230.00 |
|
| VC101704 | Myc-DDK-tagged ORF clone of viral ORF for ORF67 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129424 |
CNY 3,800.00 |
|
| VC101705 | Myc-DDK-tagged ORF clone of viral ORF for ORF67A [Human herpesvirus 8], codon optimized for human cell expression, YP_001129425 |
CNY 3,800.00 |
|
| VC101706 | Myc-DDK-tagged ORF clone of viral ORF for ORF68 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129426 |
CNY 5,700.00 |
|
| VC101707 | Myc-DDK-tagged ORF clone of viral ORF for ORF69 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129427 |
CNY 3,800.00 |
|
| VC101708 | Myc-DDK-tagged ORF clone of viral ORF for K12 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129428 |
CNY 3,800.00 |
|
| VC101709 | Myc-DDK-tagged ORF clone of viral ORF for K13 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129429 |
CNY 3,800.00 |
|
| VC101710 | Myc-DDK-tagged ORF clone of viral ORF for ORF72 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129430 |
CNY 3,800.00 |
|
| VC101712 | Myc-DDK-tagged ORF clone of viral ORF for K14 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129432 |
CNY 3,800.00 |
|
| VC101713 | Myc-DDK-tagged ORF clone of viral ORF for ORF74 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129433 |
CNY 5,488.00 |
|
| VC101714 | Myc-DDK-tagged ORF clone of viral ORF for ORF75 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129434 |
CNY 19,570.00 |
|
| VC101715 | Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129435 |
CNY 5,990.00 |
