Epigen (EPGN) (NM_001013442) Human Recombinant Protein
CAT#: TP314501
Recombinant protein of human epithelial mitogen homolog (mouse) (EPGN), 20 µg
View other "Epigen" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214501 representing NM_001013442
Red=Cloning site Green=Tags(s) MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHEL EKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001013460 |
Locus ID | 255324 |
UniProt ID | Q6UW88 |
Refseq Size | 847 |
Cytogenetics | 4q13.3 |
Refseq ORF | 399 |
Synonyms | ALGV3072; EPG; epigen; PRO9904 |
Summary | The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422978 | EPGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422978 | Transient overexpression lysate of epithelial mitogen homolog (mouse) (EPGN) |
CNY 3,080.00 |
|
PH314501 | EPGN MS Standard C13 and N15-labeled recombinant protein (NP_001013460) |
CNY 19,520.00 |