Bccip (NM_025392) Mouse Recombinant Protein

CAT#: TP504529

Purified recombinant protein of Mouse BRCA2 and CDKN1A interacting protein (Bccip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204529 representing NM_025392
Red=Cloning site Green=Tags(s)

MASKAKKRAVGNGIQRPLGAPGQREEEEEEEDEVEDEEEDEDDSDEEEDEVDEIVDEEVNIEFEAYSISD
NDYGGIKKLLQQLFLKAPVNTAELTNLLMQQNHIGSVIKQTDVSEDSDDEVDEDEIFGFISLLNLTERKG
TQCAEQIKELVLSFCEKTCEQSMVEQLDKLLNDTSKPVGLLLSERFINVPPQIALPMHQQLQKELSEARR
TNKPCGKCCFYLLISKTFMEAGKSSSRKRQDSLQQGALMFANAEEEFFYEKAILKFSYSVQGESDTRLGG
RWSFDDVPMTPLRTVMVIPDDRMNEIMETLKDHLSV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079668
Locus ID 66165
UniProt ID Q9CWI3
Refseq Size 1260
Cytogenetics 7 F3
Refseq ORF 948
Synonyms 1110013J05Rik; TOK-1
Summary During interphase, required for microtubule organizing and anchoring activities. During mitosis, required for the organization and stabilization of the spindle pole (PubMed:28394342). May promote cell cycle arrest by enhancing the inhibition of CDK2 activity by CDKN1A. May be required for repair of DNA damage by homologous recombination in conjunction with BRCA2. May not be involved in non-homologous end joining (NHEJ) (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...