Bccip (NM_025392) Mouse Recombinant Protein
CAT#: TP504529
Purified recombinant protein of Mouse BRCA2 and CDKN1A interacting protein (Bccip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204529 representing NM_025392
Red=Cloning site Green=Tags(s) MASKAKKRAVGNGIQRPLGAPGQREEEEEEEDEVEDEEEDEDDSDEEEDEVDEIVDEEVNIEFEAYSISD NDYGGIKKLLQQLFLKAPVNTAELTNLLMQQNHIGSVIKQTDVSEDSDDEVDEDEIFGFISLLNLTERKG TQCAEQIKELVLSFCEKTCEQSMVEQLDKLLNDTSKPVGLLLSERFINVPPQIALPMHQQLQKELSEARR TNKPCGKCCFYLLISKTFMEAGKSSSRKRQDSLQQGALMFANAEEEFFYEKAILKFSYSVQGESDTRLGG RWSFDDVPMTPLRTVMVIPDDRMNEIMETLKDHLSV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 36.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079668 |
Locus ID | 66165 |
UniProt ID | Q9CWI3 |
Refseq Size | 1260 |
Cytogenetics | 7 F3 |
Refseq ORF | 948 |
Synonyms | 1110013J05Rik; TOK-1 |
Summary | During interphase, required for microtubule organizing and anchoring activities. During mitosis, required for the organization and stabilization of the spindle pole (PubMed:28394342). May promote cell cycle arrest by enhancing the inhibition of CDK2 activity by CDKN1A. May be required for repair of DNA damage by homologous recombination in conjunction with BRCA2. May not be involved in non-homologous end joining (NHEJ) (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |