Dtl (NM_029766) Mouse Recombinant Protein
CAT#: TP516290
Purified recombinant protein of Mouse denticleless E3 ubiquitin protein ligase (Dtl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR216290 representing NM_029766
Red=Cloning site Green=Tags(s) MLFNSVLRQPQLGVLRNGWSSHYPLQSLLSGYQCNCNDEHTSYGETGVPVPPFGCTFCTAPSMEHILAVA NEEGFVRLYNTESQTSKKTCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVRAGELMGTCKGHQ CSLKSVAFPKFQKAVFSTGGRDGNIMIWDTRCNKKDGFYRQVNQISGAHNTADKQTPSKPKKKQNSKGLA PAVDSQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGTSTRKLGYSSLVLD STGSTLFANCTDDNIYMFNMTGLKTSPVAVFNGHQNSTFYVKSSLSPDDQFLISGSSDEAAYIWKVSMPW HPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGDKHSIVGWTSQKKKEVKACPV TVPSSQSTPAKAPRAKSSPSISSPSSAACTPSCAGDLPLPSSTPTFSVKTTPATTRSSVSRRGSISSVSP KPLSSFKMSLRNWVTRTPSSSPPVTPPASETKISSPRKALIPVSQKSSQADACSESRNRVKRRLDSSCLE SVKQKCVKSCNCVTELDGQAESLRLDLCCLSGTQEVLSQDSEGPTKSSKTEGAGTSISEPPSPVSPYASE GCGPLPLPLRPCGEGSEMVGKENSSPENKNWLLAIAAKRKAENSSPRSPSSQTPSSRRQSGKTSPGPVTI TPSSMRKICTYFRRKTQDDFCSPEHSTEL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 79.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_084042 |
Locus ID | 76843 |
UniProt ID | Q3TLR7 |
Refseq Size | 4202 |
Cytogenetics | 1 H6 |
Refseq ORF | 2187 |
Synonyms | 2810047L02Rik; 5730564G15Rik; L2dtl; Ramp |
Summary | Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21(CIP1), FBH1, KMT5A and SDE2. CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis. The DDB1-CUL4A-DTL E3 ligase complex regulates the circadian clock function by mediating the ubiquitination and degradation of CRY1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |