Il1f6 (NM_019450) Mouse Tagged ORF Clone

CAT#: MG225118

  • TrueORF®

Il1f6 (tGFP-tagged) - Mouse interleukin 1 family member 6 (Il1f6), (10ug)

ORF Plasmid: DDK tGFP



  "NM_019450" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms Fil1; IL-1H1; Il1f9; IL1RP2; Il36a
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG225118 representing NM_019450
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATAAGGAGAAAGAACTAAGAGCAGCATCACCTTCGCTTAGACATGTTCAGGATCTTAGTAGTCGTG
TGTGGATCCTGCAGAACAATATCCTCACTGCAGTCCCAAGGAAAGAGCAAACAGTTCCAGTCACTATTAC
CTTGCTCCCATGCCAATATCTGGACACTCTTGAGACGAACAGGGGGGATCCCACGTACATGGGAGTGCAA
AGGCCGATGAGCTGCCTGTTCTGCACAAAGGATGGGGAGCAGCCTGTGCTACAGCTTGGGGAAGGGAACA
TAATGGAAATGTACAACAAAAAGGAACCTGTAAAAGCCTCTCTCTTCTATCACAAGAAGAGTGGTACAAC
CTCTACATTTGAGTCTGCAGCCTTCCCTGGTTGGTTCATCGCTGTCTGCTCTAAAGGGAGCTGCCCACTC
ATTCTGACCCAAGAACTGGGGGAAATCTTCATCACTGACTTCGAGATGATTGTGGTACAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG225118 representing NM_019450
Red=Cloning site Green=Tags(s)

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQ
RPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPL
ILTQELGEIFITDFEMIVVH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_019450
ORF Size 480 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_019450.3, NP_062323.1
RefSeq Size 883 bp
RefSeq ORF 483 bp
Locus ID 54448
UniProt ID Q9JLA2
Gene Summary Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. Induces the production of proinflammatory cytokines, including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23 in bone marrow-derived dendritic cells (BMDCs). Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T-cells and splenocytes. May play a role in proinflammatory effects in the lung: induces the expression of CXCL1 and CXCL2 in the lung, and the expression of TNF-alpha, IL-36c, IL-1A, IL-1B, CXCL1 and CXCL2 in isolated splenic CD11c(+) alveolar macrophages. May be involved in T-cell maturation by stimulating the surface expression of CD40 and modestly CD80 and CD86 in splenic CD11c(+) cells. May be involved in CD4(+) T-cell proliferation. Induces NF-kappa B activation in macrophages.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...