LC3B (MAP1LC3B) (NM_022818) Human Tagged ORF Clone
CAT#: RC207356
- TrueORF®
MAP1LC3B (Myc-DDK-tagged)-Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B)
ORF Plasmid: tGFP
"NM_022818" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 5,130.00
Cited in 13 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ATG8F; LC3B; MAP1A/1BLC3; MAP1LC3B-a |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207356 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGTCGGAGAAGACCTTCAAGCAGCGCCGCACCTTCGAACAAAGAGTAGAAGATGTCCGACTTATTC GAGAGCAGCATCCAACCAAAATCCCGGTGATAATAGAACGATACAAGGGTGAGAAGCAGCTTCCTGTTCT GGATAAAACAAAGTTCCTTGTACCTGACCATGTCAACATGAGTGAGCTCATCAAGATAATTAGAAGGCGC TTACAGCTCAATGCTAATCAGGCCTTCTTCCTGTTGGTGAACGGACACAGCATGGTCAGCGTCTCCACAC CAATCTCAGAGGTGTATGAGAGTGAGAAAGATGAAGATGGATTCCTGTACATGGTCTATGCCTCCCAGGA GACGTTCGGGATGAAATTGTCAGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207356 protein sequence
Red=Cloning site Green=Tags(s) MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_022818 |
ORF Size | 375 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_022818.5 |
RefSeq Size | 2304 bp |
RefSeq ORF | 378 bp |
Locus ID | 81631 |
UniProt ID | Q9GZQ8 |
Domains | MAP1_LC3 |
MW | 14.7 kDa |
Gene Summary | The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. [provided by RefSeq, Jul 2008] |
Citations (13)
The use of this cDNA Clones has been cited in the following citations: |
---|
Autophagy inhibition and reactive oxygen species elimination by acetyl-CoA acetyltransferase 1 through fused in sarcoma protein to promote prostate cancer
,null,
BMC Cancer
,PubMed ID 36517760
[MAP1LC3B]
|
NGFR Increases the Chemosensitivity of Colorectal Cancer Cells by Enhancing the Apoptotic and Autophagic Effects of 5-fluorouracil via the Activation of S100A9
,null,
Frontiers in Oncology
,PubMed ID 33996571
[MAP1LC3B]
|
Expression of transmembrane protein 41A is associated with metastasis via the modulation of E‑cadherin in radically resected gastric cancer.
,null,
Molecular medicine reports
,PubMed ID 30015937
[MAP1LC3B]
|
CHAC2, downregulated in gastric and colorectal cancers, acted as a tumor suppressor inducing apoptosis and autophagy through unfolded protein response
,null,
Cell Death & Disease
,PubMed ID 28837156
[MAP1LC3B]
|
Oestrogen Inhibits Arterial Calcification by Promoting Autophagy
,null,
Scientific Reports
,PubMed ID 28615727
[MAP1LC3B]
|
A novel ECG analog 4-(S)-(2,4,6-trimethylthiobenzyl)-epigallocatechin gallate selectively induces apoptosis of B16-F10 melanoma via activation of autophagy and ROS
,null,
Scientific Reports
,PubMed ID 28186123
[MAP1LC3B]
|
Metformin Restores Parkin-Mediated Mitophagy, Suppressed by Cytosolic p53
,null,
International Journal of Molecular Sciences
,PubMed ID 26784190
[MAP1LC3B]
|
Nuclear localization of the p17 protein of avian reovirus is correlated with autophagy induction and an increase in viral replication.
,null,
Archives of virology
,PubMed ID 26350773
[MAP1LC3B]
|
Bone marrow-derived mesenchymal stem cells ameliorate chronic high glucose-induced β-cell injury through modulation of autophagy
,null,
Cell Death & Disease
,PubMed ID 26379190
[MAP1LC3B]
|
Enhancement of Autophagy by Simvastatin through Inhibition of Rac1-mTOR Signaling Pathway in Coronary Arterial Myocytes
,null,
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology
,PubMed ID 23817226
[MAP1LC3B]
|
Manipulation of autophagy by HCMV infection is involved in mTOR and influences the replication of virus.
,null,
Acta biochimica et biophysica Sinica
,PubMed ID 24108761
[MAP1LC3B]
|
Autophagy Benefits the Replication of Newcastle Disease Virus in Chicken Cells and Tissues
,null,
Journal of Virology
,PubMed ID 24173218
[MAP1LC3B]
|
Glycated albumin causes pancreatic β-cells dysfunction through autophagy dysfunction.
,null,
Endocrinology
,PubMed ID 23698718
[MAP1LC3B]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207356L1 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC207356L2 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), mGFP tagged |
CNY 4,200.00 |
|
RC207356L3 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC207356L4 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), mGFP tagged |
CNY 4,200.00 |
|
RG207356 | MAP1LC3B (tGFP-tagged) - Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) |
CNY 3,400.00 |
|
SC108102 | MAP1LC3B (untagged)-Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) |
CNY 1,800.00 |
|
SC322139 | MAP1LC3B (untagged)-Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) |
CNY 1,800.00 |