C8orf42 (TDRP) (NM_175075) Human Recombinant Protein
CAT#: TP313199
Recombinant protein of human chromosome 8 open reading frame 42 (C8orf42), 20 µg
View other "C8orf42" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213199 representing NM_175075
Red=Cloning site Green=Tags(s) MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGA RLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSP KSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWE DDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_778250 |
Locus ID | 157695 |
UniProt ID | Q86YL5 |
Refseq Size | 1901 |
Cytogenetics | 8p23.3 |
Refseq ORF | 774 |
Synonyms | C8orf42; Inm01; TDRP1; TDRP2 |
Summary | Contributes to normal sperm motility, but not essential for male fertility.[UniProtKB/Swiss-Prot Function] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Immuno-moodulin: a new anxiogenic factor produced by Annexin-A1 transgenic autoimmune-prone T cells
,Piras, G;Rattazzi, L;Paschalidis, N;Oggero, S;Berti, G;Ono, M;Bellia, F;D'Addario, C;Dell'Osso, B;Maria Pariante, C;Perretti, M;D'Acquisto, F;,
Brain, Behavior, and Immunity
,PubMed ID 32126289
[TDRP]
|
Immuno-moodulin: a new anxiogenic factor produced by autoimmune-prone T cells
,Piras, G;Rattazzi, L;Paschalidis, N;Oggero, S;Berti, G;,
bioRxiv
[TDRP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406313 | TDRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406313 | Transient overexpression lysate of chromosome 8 open reading frame 42 (C8orf42) |
CNY 3,080.00 |
|
PH313199 | C8orf42 MS Standard C13 and N15-labeled recombinant protein (NP_778250) |
CNY 19,520.00 |
其它C8orf42产品