TMIE (NM_147196) Human Recombinant Protein
CAT#: TP320050
Recombinant protein of human transmembrane inner ear (TMIE), 20 µg
View other "TMIE" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220050 protein sequence
Red=Cloning site Green=Tags(s) MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSI IITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV EEDEKNEAKKKKGEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_671729 |
Locus ID | 259236 |
UniProt ID | Q8NEW7 |
Refseq Size | 1861 |
Cytogenetics | 3p21.31 |
Refseq ORF | 465 |
Synonyms | DFNB6 |
Summary | This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. [provided by RefSeq, Mar 2009] |
Protein Families | Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
TMIE Defines Pore and Gating Properties of the Mechanotransduction Channel of Mammalian Cochlear Hair Cells
,Cunningham, CL;Qiu, X;Wu, Z;Zhao, B;Peng, G;Kim, YH;Lauer, A;Müller, U;,
Neuron
,PubMed ID 32343945
[TMIE]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407788 | TMIE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407788 | Transient overexpression lysate of transmembrane inner ear (TMIE) |
CNY 3,080.00 |
|
PH320050 | TMIE MS Standard C13 and N15-labeled recombinant protein (NP_671729) |
CNY 19,520.00 |