TMIE (NM_147196) Human Mass Spec Standard
CAT#: PH320050
TMIE MS Standard C13 and N15-labeled recombinant protein (NP_671729)
View other "TMIE" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TMIE MS Standard C13 and N15-labeled recombinant protein (NP_671729) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220050 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC220050 protein sequence
Red=Cloning site Green=Tags(s) MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSI IITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV EEDEKNEAKKKKGEK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_671729 |
RefSeq Size | 1861 |
RefSeq ORF | 465 |
Synonyms | DFNB6 |
Locus ID | 259236 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. [provided by RefSeq, Mar 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407788 | TMIE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407788 | Transient overexpression lysate of transmembrane inner ear (TMIE) |
CNY 3,080.00 |
|
TP320050 | Recombinant protein of human transmembrane inner ear (TMIE), 20 µg |
CNY 2,900.00 |