Mapkapk3 (NM_178907) Mouse Recombinant Protein

CAT#: TP505996

Purified recombinant protein of Mouse mitogen-activated protein kinase-activated protein kinase 3 (Mapkapk3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205996 protein sequence
Red=Cloning site Green=Tags(s)

MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKVLECYHRRSGQ
KCALKLLYDSPKARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVMECMEGGELFSRIQERGDQAF
TEREAAEIMRDIGTAIQFLHSRNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYY
VAPEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYSFPNPEWLDVSEDAK
QLIRLLLKTDPTERLTIMQFMNHPWINQSMVVPQTPLYTARVLQEDKDHWDDVKEEMTSALATMRVDYDQ
VKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 43.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_849238
Locus ID 102626
UniProt ID Q3UMW7
Refseq Size 2816
Cytogenetics 9 F1
Refseq ORF 1155
Synonyms 3PK; AI874665; MAPKAP-K3; MAPKAP3; MapkKapk3; MK-3; MK3
Summary Stress-activated serine/threonine-protein kinase involved in cytokines production, endocytosis, cell migration, chromatin remodeling and transcriptional regulation. Following stress, it is phosphorylated and activated by MAP kinase p38-alpha/MAPK14, leading to phosphorylation of substrates. Phosphorylates serine in the peptide sequence, Hyd-X-R-X(2)-S, where Hyd is a large hydrophobic residue. MAPKAPK2 and MAPKAPK3, share the same function and substrate specificity, but MAPKAPK3 kinase activity and level in protein expression are lower compared to MAPKAPK2. Phosphorylates HSP27/HSPB1, KRT18, KRT20, RCSD1, RPS6KA3, TAB3 and TTP/ZFP36. Mediates phosphorylation of HSP27/HSPB1 in response to stress, leading to dissociate HSP27/HSPB1 from large small heat-shock protein (sHsps) oligomers and impair their chaperone activities and ability to protect against oxidative stress effectively. Involved in inflammatory response by regulating tumor necrosis factor (TNF) and IL6 production post-transcriptionally: acts by phosphorylating AU-rich elements (AREs)-binding proteins, such as TTP/ZFP36, leading to regulate the stability and translation of TNF and IL6 mRNAs. Phosphorylation of TTP/ZFP36, a major post-transcriptional regulator of TNF, promotes its binding to 14-3-3 proteins and reduces its ARE mRNA affinity leading to inhibition of dependent degradation of ARE-containing transcript. Involved in toll-like receptor signaling pathway (TLR) in dendritic cells: required for acute TLR-induced macropinocytosis by phosphorylating and activating RPS6KA3. Also acts as a modulator of Polycomb-mediated repression.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...