Gria2 Mouse Monoclonal Antibody [Clone ID: L21/32]

Specifications

Product Data
Clone Name	L21/32
Applications	IHC, WB
Recommend Dilution	Immunoblot (IB) Immunohistochemistry (IHC) Immuno-gold EM
Reactivity	Human, Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGY NVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491). Mouse: 98% identity (49/50 amino acids identical)  Human: 98% identity (49/50 amino acids identical) 100% identity between Flip and Flop isoforms >70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	glutamate ionotropic receptor AMPA type subunit 2
Database Link	Entrez Gene 29627 Rat UniProt ID P19491
Synonyms	GluR-B, GluR-K2, Glutamate receptor ionotropic, AMPA2, GRIA2
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.