Scn1a Mouse Monoclonal Antibody [Clone ID: K74/71]

CAT#: 75-023

Scn1a mouse monoclonal antibody, clone K74/71



Need it in bulk or conjugated?
Get a free quote

CNY 7,575.00


货期*
3周

规格
    • 100 ul

Product images

Specifications

Product Data
Clone Name K74/71
Applications IF, IHC, IP, WB
Recommend Dilution Immunoblot (IB).
Immunohistochemistry (IHC). 
Immunocytochemistry (ICC).
Immunoprecipitation (IP).
Reactivity Human, Mouse, Rat
Host Mouse
Clonality Monoclonal
Immunogen Fusion protein amino acids 1929-2009 (cytoplasmic C-terminus, HLLKRTVKQASFTY NKNKLKGGANLLVKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK) of rat Voltage-gated sodium channel subunit alpha Nav1.1 (also known as Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, Scn1a, NAC1 and SCN1, accession number P04774).
Mouse: 98% identity (80/81 amino acids identical).
Human: 97% identity (79/81 amino acids identical).
~50% identity with Nav1.2 and Nav1.3.
Specificity Does not cross-react with Nav1.2 or Nav1.3.
Formulation State: Purified
Conjugation Unconjugated
Gene Name sodium voltage-gated channel alpha subunit 1
Synonyms NAC1, SCN1
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...