Scn1a Mouse Monoclonal Antibody [Clone ID: K74/71]

Specifications

Product Data
Clone Name	K74/71
Applications	IF, IHC, IP, WB
Recommend Dilution	Immunoblot (IB). Immunohistochemistry (IHC). Immunocytochemistry (ICC). Immunoprecipitation (IP).
Reactivity	Human, Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 1929-2009 (cytoplasmic C-terminus, HLLKRTVKQASFTY NKNKLKGGANLLVKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK) of rat Voltage-gated sodium channel subunit alpha Nav1.1 (also known as Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, Scn1a, NAC1 and SCN1, accession number P04774). Mouse: 98% identity (80/81 amino acids identical). Human: 97% identity (79/81 amino acids identical). ~50% identity with Nav1.2 and Nav1.3.
Specificity	Does not cross-react with Nav1.2 or Nav1.3.
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	sodium voltage-gated channel alpha subunit 1
Database Link	Entrez Gene 81574 Rat UniProt ID P04774
Synonyms	NAC1, SCN1
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.