Atxn1 Mouse Monoclonal Antibody [Clone ID: N76/3]

Specifications

Product Data
Clone Name	N76/3
Applications	IHC, IP, WB
Recommend Dilution	Immunoblot (IB) Immunohistochemistry (IHC) Immunoprecipitation (IP)
Reactivity	Human, Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (also known as spinocerebellar ataxia type 1 protein homolog, accession number P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	ataxin 1
Database Link	Entrez Gene 20238 Mouse UniProt ID P54254
Synonyms	Ataxin 1, ATXN1, ATX1, SCA1
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.