Abcc8 Mouse Monoclonal Antibody [Clone ID: N289/16]

Specifications

Product Data
Clone Name	N289/16
Applications	IF, IHC, WB
Recommend Dilution	Immunoblot (IB) Immunohistochemistry (IHC) Immunocytochemistry (ICC)
Reactivity	Hamster, Human, Mouse
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS,ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429). Mouse: 100% identity (35/35 amino acids identical). Human: 94% identity (33/35 amino acids identical). Similar % identity with other isoforms. >70% identity with SUR2B.
Specificity	Does not cross-react with SUR2B
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	ATP binding cassette subfamily C member 8
Database Link	UniProt ID Q09429
Synonyms	HRINS, SUR, SUR1, Sulfonylurea receptor 1
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.