Kcnj11 Mouse Monoclonal Antibody [Clone ID: N363/71]

Specifications

Product Data
Clone Name	N363/71
Applications	IF, IHC, WB
Recommend Dilution	Immunoblot (IB). Immunocytochemistry (ICC). Immunohistochemistry (IHC).
Reactivity	Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISP DSLS, cytoplasmic C-terminus) of rat Kir6.2 (also known as ATP-sensitive inward rectifier potassium channel 11, Potassium channel inwardly rectifying subfamily J member 11, IKATP, Kcnj11 and BIR, accession number P70673). Mouse: 100% identity (46/46 amino acids identical). Human: 89% identity (41/46 amino acids identical). <50% identity with Kir6.1.
Specificity	Does not cross-react with Kir6.1
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	potassium voltage-gated channel subfamily J member 11
Database Link	Entrez Gene 83535 Rat UniProt ID P70673
Synonyms	KCNJ11, Inward rectifier K+ channel Kir6.2, IKATP
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.