Kcnj1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB: 1:200-1:2000; IHC: 1:100-1:3000
Reactivity	Mouse, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1, (MW: 33 kDa). Intracellular, C-terminus.
Formulation	Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.025% NaN3.
Reconstitution Method	Add 50 ul double distilled water (DDW) to the lyophilized powder.
Purification	The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST, and then the antibody was affinity purified on immobilized Kir1.1-GST.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Gene Name	potassium voltage-gated channel subfamily J member 1
Database Link	NP_058719 Entrez Gene 56379 MouseEntrez Gene 24521 Rat
Background	Kir1.1 (ROMK1) was the first member of the family of inward rectifying K+ channels to be cloned. The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.The familyâ??s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels the functional unit for the Kir channels is composed of four subunits that can assembly as either homo or heterotetramers.Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.As its original name indicates (ROMK1 stands for Renal Outer Medullary K+ channel) Kir1.1 is strongly expressed in the kidney in the apical membrane of several kidney segments such as the thick ascending loop of Henle (TAL) and the cortical collecting duct (CCD). In addition, the channel is also expressed in the brain mainly in the cortex and hippocampus.Kir1.1 plays a key role in K+ recycling in the loop of Henle. Indeed, loss of function mutations in the Kir1.1 gene cause Bartterâ??s syndrome type II, a recessive autosomal disease characterized by the impairment of K+ efflux and the subsequent inability of the NKCC2 transporter to continue NaCl uptake. This leads to a high salt concentration in the urine that induces osmotic diuresis and low plasma volume.Pharmacologically, the Kir1.1 channel can be inhibited by several general K+ channel blockers such as Tertiapin (#STT-250), however the scorpion toxin Lq2 (#RTL-550) specifically and potently inhibits Kir1.1 channels.
Synonyms	Kir1.1; OTTHUMP00000045938; ROMK; ROMK1
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.