Dlg2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB: 1:200-1:2000; IHC: 1:100-1:3000
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat chapsyn-110. Between PDZ2 and PDZ3 domains.
Formulation	Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Reconstitution Method	Add 50 ul double distilled water (DDW) to the lyophilized powder.
Purification	The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST, and then IgG fraction was purified on Protein A-Sepharose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Gene Name	discs large homolog 2
Database Link	NP_071618 Entrez Gene 64053 Rat UniProt ID Q63622
Background	Chapsyn 110 (also known as PSD93 and DLG2) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins. PDZ domains are conserved protein domains of about 90 amino acids involved in protein–protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs Large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity). MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain. The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes. Indeed, Chapsyn 110 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity.
Synonyms	chapsyn-110; DKFZp781D1854; DKFZp781E0954; FLJ37266; MGC131811; OTTHUMP00000165971; PSD-93; PSD93
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.