Aqp4 Rabbit Polyclonal Antibody

CAT#: TA329016

Rabbit polyclonal Anti-Aquaporin 4 (249-323)



Need it in bulk or conjugated?
Get a free quote

CNY 11,000.00


货期*
7周

规格
    • 50 ul

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB: 1:200-1:2000; IHC: 1:100-1:3,000; FC: 1:50-1:600
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Immunogen GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSK AAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGK DSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4. Intracellular, C-terminus.
Formulation Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Reconstitution Method Add 50 ul double distilled water (DDW) to the lyophilized powder.
Purification The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST, and then affinity purified with Protein A chromatography.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Gene Name aquaporin 4
Background Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12). The aquaporins can be divided into two functional groups based on their permability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belongs to the first group. Little is known about the function of the two newest members, AQP-11 and AQP-12. The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores. AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4- mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance. In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-4.
Synonyms AQP-4; aquaporin-4; HMIWC2; MGC22454; MIWC; WCH4
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...