Aqp4 Rabbit Polyclonal Antibody
CAT#: TA329016
Rabbit polyclonal Anti-Aquaporin 4 (249-323)
Need it in bulk or conjugated?
Get a free quote
CNY 11,000.00
货期*
7周
规格
经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB: 1:200-1:2000; IHC: 1:100-1:3,000; FC: 1:50-1:600 |
Reactivity | Human, Mouse, Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSK AAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGK DSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4. Intracellular, C-terminus. |
Formulation | Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3. |
Reconstitution Method | Add 50 ul double distilled water (DDW) to the lyophilized powder. |
Purification | The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST, and then affinity purified with Protein A chromatography. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Gene Name | aquaporin 4 |
Database Link | |
Background | Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12). The aquaporins can be divided into two functional groups based on their permability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belongs to the first group. Little is known about the function of the two newest members, AQP-11 and AQP-12. The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores. AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4- mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance. In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-4. |
Synonyms | AQP-4; aquaporin-4; HMIWC2; MGC22454; MIWC; WCH4 |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
Customer
Reviews
Loading...