EOMES Rabbit Polyclonal Antibody
CAT#: TA329112
Rabbit Polyclonal anti-EOMES antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EOMES antibody: synthetic peptide directed towards the N terminal of human EOMES. Synthetic peptide located within the following region: SVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 73 kDa |
Gene Name | eomesodermin |
Database Link | |
Background | EOMES is a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. |
Synonyms | TBR2 |
Note | Immunogen sequence homology: Human: 100%; Mouse: 93%; Rabbit: 90%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79% |
Reference Data | |
Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |