Runx2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Runx2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	runt-related transcription factor 2
Database Link	NP_445922 Entrez Gene 367218 Rat
Background	The function of Runx2 remains unknown.
Synonyms	AML3; CBF-alpha-1; CBFA1; CCD; CCD1; MGC120022; MGC120023; OSF-2; OSF2; PEA2aA; PEBP2A; PEBP2A1; PEBP2A2; PEBP2aA; PEBP2aA1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.