NFIL3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	nuclear factor, interleukin 3 regulated
Database Link	NP_005375 Entrez Gene 18030 MouseEntrez Gene 4783 Human UniProt ID Q16649
Background	NFIL3 is a basic leucine zipper (bZIP) transcription factor that represses or activates transcription in non-osteoblastic cells. NFIL3 play a role in attenuation of PTH target gene transcription in osteoblasts. NFIL3 repression domain interacts specifically with the TBP binding repressor protein Dr1.Glucocorticoid-mediated upregulation of the bZIP transcriptional repressor gene, NFIL3, is dependent on [Ca2+]i levels, and correlates with Glucocorticoid-evoked apoptosis of Glucocorticoid-sensitive CEM-C7-14 cells. NFIL3 is involved in a distinct growth factor-regulated signaling pathway that is responsible for the survival of early B-cell progenitors, and whose alteration by E2A-HLF leads to childhood B lineage leukemia.
Synonyms	E4BP4; IL3BP1; NF-IL3A; NFIL3A
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.