Gabpa Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Gabpa antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gabpa. Synthetic peptide located within the following region: MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	GA repeat binding protein, alpha
Database Link	NP_032091 Entrez Gene 14390 Mouse UniProt ID Q00422
Background	Gabpa is a transcription factor capable of interacting with purine rich repeats (GA repeats).
Synonyms	E4TF1-60; E4TF1A; NFT2; NRF2; NRF2A; OTTHUMP00000096114
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.