ZNF274 Rabbit Polyclonal Antibody

CAT#: TA329310

Rabbit Polyclonal anti-ZNF274 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of zinc finger protein 274 (ZNF274), transcript variant ZNF274c
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF274 antibody: synthetic peptide directed towards the N terminal of human ZNF274. Synthetic peptide located within the following region: YPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 62 kDa
Gene Name zinc finger protein 274
Background ZNF274 is a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus.This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals.
Synonyms HFB101; ZF2; ZKSCAN19; ZSCAN51
Note Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families Transcription Factors
Protein Pathways Neurotrophin signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...