ZNF274 Rabbit Polyclonal Antibody
CAT#: TA329310
Rabbit Polyclonal anti-ZNF274 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF274 antibody: synthetic peptide directed towards the N terminal of human ZNF274. Synthetic peptide located within the following region: YPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 62 kDa |
Gene Name | zinc finger protein 274 |
Database Link | |
Background | ZNF274 is a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus.This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals. |
Synonyms | HFB101; ZF2; ZKSCAN19; ZSCAN51 |
Note | Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Neurotrophin signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |