Prdm4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Prdm4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prdm4. Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	PR domain containing 4
Database Link	NP_857633 Entrez Gene 72843 Mouse UniProt ID Q80V63
Background	Prdm4 may function as a transcription factor involved in cell differentiation.
Synonyms	MGC45046; PFM1
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Mouse: 92%; Yeast: 92%; Bovine: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.