Lhx8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Lhx8 antibody is: synthetic peptide directed towards the N-terminal region of Rat Lhx8. Synthetic peptide located within the following region: MSEECGRPAALAAGRTRKGAGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	LIM homeobox 8
Database Link	NP_001012219 Entrez Gene 365963 Rat
Background	Lhx8 may play a role in development of the cholinergic system.
Synonyms	Lhx7
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.