ZNF652 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF652 antibody: synthetic peptide directed towards the N terminal of human ZNF652. Synthetic peptide located within the following region: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	zinc finger protein 652
Database Link	NP_055712 Entrez Gene 22834 Human UniProt ID Q9Y2D9
Background	ZNF652 is a new candidate transcription factor.
Synonyms	DKFZp781E2122; KIAA0924
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Goat: 91%; Yeast: 91%; Rabbit: 90%; Bovine: 88%; Horse: 87%; Pig: 78%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.