AATF Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	apoptosis antagonizing transcription factor
Database Link	NP_036270 Entrez Gene 26574 Human UniProt ID Q9NY61
Background	The AATF gene encodes a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Synonyms	BFR2; CHE-1; CHE1; DED
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Rat: 90%; Yeast: 90%; Horse: 85%; Dog: 77%; Mouse: 77%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.