KLF15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLF15 antibody: synthetic peptide directed towards the middle region of human KLF15. Synthetic peptide located within the following region: GPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	Kruppel-like factor 15
Database Link	NP_054798 Entrez Gene 28999 Human UniProt ID Q9UIH9
Background	KLF15 is a Cys2-His2 zinc finger gene. It is found abundantly expressed in the liver, kidneys, heart, and skeletal muscle.
Synonyms	KKLF
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 92%; Dog: 91%; Horse: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.