LRRC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRC2 antibody: synthetic peptide directed towards the N terminal of human LRRC2. Synthetic peptide located within the following region: GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	leucine rich repeat containing 2
Database Link	NP_079026 Entrez Gene 79442 Human UniProt ID Q9BYS8
Background	The function remains unknown.
Synonyms	leucine-rich repeat-containing 2; leucine rich repeat containing 2
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.