ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	121 kDa
Gene Name	ATP citrate lyase
Database Link	NP_001087 Entrez Gene 47 Human UniProt ID P53396
Background	RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain (Dear et al., 1993 [PubMed 8099440]). [supplied by OMIM, Mar 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC017291.2, BG828093.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025095 [ECO:0000348] ##Evidence-Data-END##
Synonyms	ACL; ATPCL; CLATP
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Horse: 92%; Sheep: 92%; Bovine: 92%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Citrate cycle (TCA cycle), Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.