Cldn3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cldn3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	claudin 3
Database Link	NP_034032 Entrez Gene 12739 Mouse UniProt ID Q9Z0G9
Background	Cldn3 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Synonyms	C7orf1; CPE-R2; CPETR2; HRVP1; RVP1
Note	Immunogen sequence homology: Mouse: 100%; Rat: 93%; Dog: 87%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.