Rgs10 Rabbit Polyclonal Antibody
CAT#: TA329547
Rabbit Polyclonal anti-Rgs10 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | FC, WB |
Recommend Dilution | WB, FACS |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Rgs10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 21 kDa |
Gene Name | regulator of G-protein signalling 10 |
Database Link | |
Background | Rgs10 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs10 associates specifically with the activated forms of the G protein subunits G(i)-alpha and G(z)-alpha but fails to interact with the structurally and functionally distinct G(s)-alpha subunit. Activity of Rgs10 on G(z)-alpha is inhibited by palmitoylation of the G-protein. |
Synonyms | RGS10 |
Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Human: 93%; Bovine: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |