E2f7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-E2f7 antibody: synthetic peptide directed towards the N terminal of mouse E2f7. Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	E2F transcription factor 7
Database Link	NP_848724 Entrez Gene 144455 HumanEntrez Gene 52679 Mouse UniProt ID Q6S7F2
Background	E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts
Synonyms	E2F-7; FLJ12981
Note	Immunogen sequence homology: Mouse: 100%; Bovine: 93%; Pig: 92%; Dog: 86%; Rat: 86%; Human: 86%; Horse: 85%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.