GLIS2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	GLIS family zinc finger 2
Database Link	NP_115964 Entrez Gene 84662 Human UniProt ID Q9BZE0
Background	Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription. [supplied by OMIM]
Synonyms	NKL; NPHP7
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Rat: 92%; Pig: 86%; Guinea pig: 86%; Rabbit: 85%; Mouse: 83%; Horse: 77%
Reference Data
Protein Families	ES Cell Differentiation/IPS

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.