GTF2H4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	general transcription factor IIH subunit 4
Database Link	NP_001508 Entrez Gene 14885 MouseEntrez Gene 2968 Human UniProt ID Q92759
Background	GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Synonyms	P52; TFB2; TFIIH
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Basal transcription factors, Nucleotide excision repair

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.