CHX10 (VSX2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHX10 antibody: synthetic peptide directed towards the C terminal of human CHX10. Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	visual system homeobox 2
Database Link	NP_878314 Entrez Gene 338917 Human UniProt ID P58304
Background	Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development.
Synonyms	CHX10; HOX10; MCOP2; MCOPCB3; RET1
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.