Nfia Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Nfia antibody is: synthetic peptide directed towards the middle region of Mouse Nfia. Synthetic peptide located within the following region: YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	nuclear factor I/A
Database Link	NP_001116424 Entrez Gene 18027 Mouse UniProt ID Q02780
Background	Nfia recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
Synonyms	CTF; DKFZp434L0422; DKFZp686J23256; FLJ39164; KIAA1439; NF-I/A; NF1-A; NFI-A; NFI-L
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.