ATP6V0D2 Rabbit Polyclonal Antibody

CAT#: TA329773

Rabbit polyclonal Anti-ATP6V0D2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 (ATP6V0D2)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 (ATP6V0D2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 (ATP6V0D2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 40 kDa
Gene Name ATPase H+ transporting V0 subunit d2
Background ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Synonyms ATP6D2; VMA6
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 86%
Reference Data
Protein Pathways Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...