SEMCAP3 (PDZRN3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PDZRN3 antibody is: synthetic peptide directed towards the N-terminal region of Human PDZRN3. Synthetic peptide located within the following region: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	PDZ domain containing ring finger 3
Database Link	NP_055824 Entrez Gene 23024 Human UniProt ID Q9UPQ7
Background	PDZRN3 is a E3 ubiquitin-protein ligase. It plays an important role in regulating the surface level of MUSK on myotubes. It mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. It might contribute to terminal myogenic differentiation.
Synonyms	LNX3; SEMACAP3; SEMCAP3
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.