Rnf6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNF6 antibody: synthetic peptide directed towards the N terminal of mouse RNF6. Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	ring finger protein (C3H2C3 type) 6
Database Link	NP_083050 Entrez Gene 74132 Mouse UniProt ID Q9DBU5
Background	Rnf6 is involved in neuronal development. High Rnf6 protein levels can be detected in developing axonal projections of motor and DRG neurons during mouse embryogenesis.
Synonyms	DKFZp686P0776; OTTHUMP00000018154
Note	Immunogen sequence homology: Mouse: 100%; Rat: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.