Nr5a2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Nr5a2 antibody: synthetic peptide directed towards the middle region of human Nr5a2. Synthetic peptide located within the following region: PQLVVNTPLQGQITSTQVTNQHLLRESNVISAQGPKPMRSSQLLPASGRS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	nuclear receptor subfamily 5, group A, member 2
Database Link	NP_109601 Entrez Gene 26424 Mouse UniProt ID P45448
Background	Nr5a2 binds to promoters containing the sequence element 5'-AACGACCGACCTTGAG-3'. Nr5a2 plays a role in the regulation of gene expression in liver and pancreas. Nr5a2 may play a role in embryonic development.
Synonyms	B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta; hB1F; hB1F-2; LRH-1; LRH1
Note	Immunogen sequence homology: Mouse: 100%; Rat: 92%; Pig: 85%; Human: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.