Hes7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Hes7 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Hes7. Synthetic peptide located within the following region: RERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	hairy and enhancer of split 7 (Drosophila)
Database Link	NP_149030 Entrez Gene 84653 Mouse UniProt ID Q8BKT2
Background	Hes7 is a transcriptional repressor. Hes7 represses transcription from both N box- and E box-containing promoters. Hes7 may with HES1, cooperatively regulate somite formation in the presomitic mesoderm (PSM). Hes7 may function as a segmentation clock, which is essential for coordinated somite segmentation.
Synonyms	bHLHb37; hHes7
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.