Smarca1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB, ChIP
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Database Link	NP_444353 Entrez Gene 6594 HumanEntrez Gene 93761 Mouse UniProt ID Q6PGB8
Background	cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
Synonyms	DKFZp686D1623; FLJ41547; ISWI; NURF140; OTTHUMP00000023983; SNF2L; SNF2L1; SNF2LB; SWI; SWI2
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.